Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNPO Peptide - C-terminal region

SYNPO Peptide - C-terminal region

Product Specifications

Product Name Alternative

SYNPO, KIAA1029

UniProt

Q8N3V7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYNPO Rabbit Polyclonal Antibody (orb588479) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPRIQAKPKPKPNQNLSEASGKGAELYARRQSRMEKYVIESSSHTPELAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CWF19L2 (m) -PR
sc-142641-PR 10 µM - 20 µL

CWF19L2 (m) -PR

Sign In for Pricing
View Details
Glod5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6646705 3x 1.0 µg

Glod5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PCDHB5 Peptide - N-terminal region (AAP47179)
AAP47179-100UG 100 µg

PCDHB5 Peptide - N-terminal region (AAP47179)

Sign In for Pricing
View Details
CYB5R3 Protein Vector (Rat) (pPB-C-His)
PV262638 500 ng

CYB5R3 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
1- (4-Chloro-2-cyanophenyl) -4-methylpiperidine-4-carboxylic acid
WAC09364-01 50 mg

1- (4-Chloro-2-cyanophenyl) -4-methylpiperidine-4-carboxylic acid

Sign In for Pricing
View Details
1- (4-Chloro-2-cyanophenyl) -4-methylpiperidine-4-carboxylic acid
WAC09364-02 0.5 g

1- (4-Chloro-2-cyanophenyl) -4-methylpiperidine-4-carboxylic acid

Sign In for Pricing
View Details