Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDM4C Peptide - C-terminal region

KDM4C Peptide - C-terminal region

Product Specifications

Product Name Alternative

KDM4C, GASC1, JHDM3C, JMJD2C, KIAA0780

UniProt

Q9H3R0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KDM4C Rabbit Polyclonal Antibody (orb588484) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LMPYHKPDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SLC25A38 Antibody
NBP1-59559 100 µL

Rabbit Polyclonal SLC25A38 Antibody

Sign In for Pricing
View Details
Anti-RET Antibody
MBS8324762-01 0.03 mL

Anti-RET Antibody

Sign In for Pricing
View Details
Anti-RET Antibody
MBS8324762-02 0.05 mL

Anti-RET Antibody

Sign In for Pricing
View Details
Anti-RET Antibody
MBS8324762-03 0.1 mL

Anti-RET Antibody

Sign In for Pricing
View Details
Anti-RET Antibody
MBS8324762-04 0.2 mL

Anti-RET Antibody

Sign In for Pricing
View Details
Anti-RET Antibody
MBS8324762-05 5x 0.2 mL

Anti-RET Antibody

Sign In for Pricing
View Details