UBXN4 Peptide - C-terminal region
UBXN4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
UBXN4, KIAA0242, UBXD2, UBXDC1
UniProt
Q92575
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UBXN4 Rabbit Polyclonal Antibody (orb327358) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_055422
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ASSSKSEKREPVRKRVLEKRGDDFKKEGKIYRLRTQDDGEDENNTWNGNS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400676-100 1x 100 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470304-500 1x 500 µL
CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details