U2SURP Peptide - N-terminal region
U2SURP Peptide - N-terminal region
Product Specifications
Product Name Alternative
SR140, fSAPa
UniProt
O15042
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with U2SURP Rabbit Polyclonal Antibody (orb588489) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KPSSRFADQKNPPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682967-500 1x 500 µL
HLA-Pan (MHC II) (HLA-Pan/2967R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![CBR4 Mouse Monoclonal Antibody [Clone ID: OTI3C10]](https://cdn.genprice.uk/products/937/68dd18bb061270361e9089f1/imageurl/cf810992.webp)
GP-6301-15 1 mL
Colloidal Gold Conjugated Artocarpus integrifolia Lectin (Jackfruit) -Jacalin, AIA-, 15nm
Sign In for Pricing
View Details 