U2SURP Peptide - N-terminal region
U2SURP Peptide - N-terminal region
Product Specifications
Product Name Alternative
SR140, fSAPa
UniProt
O15042
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with U2SURP Rabbit Polyclonal Antibody (orb588489) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KPSSRFADQKNPPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-C989045-25MG 25 mg
1-Cyclopropyl-6,7,8-trifluoro-1,4-dihydro-4-oxo-3-quinolinecarboxylic Acid Anhydride with Diacetyl Borate
Sign In for Pricing
View Details 
![DOT1L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11H2]](https://cdn.genprice.uk/products/937/6868c3a0994c49e6dc3fba74/imageurl/ta802741bm.webp)
TA802741BM 100 µL
DOT1L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11H2]
Sign In for Pricing
View Details 
BNC681132-100 1x 100 µL
CD45RB (PTPRC/1132), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682036-100 1x 100 µL
Cytokeratin 5/6/18 (LP34), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details