CARHSP1 Peptide - C-terminal region
CARHSP1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CSDC1, CRHSP24, CRHSP-24
UniProt
Q9Y2V2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CARHSP1 Rabbit Polyclonal Antibody (orb327361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
XP_005255286
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EGEYVPVEGDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWSGHVI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940994-100 1x 100 µL
TNF alpha (J2D10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472324-500 1x 500 µL
Neurofilament (NF-H) (Neuronal Marker) (NEFL.H/2324R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942342-500 1x 500 µL
Calcineurin B / PPP3R1 (CALNB/2342), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details