Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKD3 Peptide - middle region

PRKD3 Peptide - middle region

Product Specifications

Product Name Alternative

EPK2, PKD3, PRKCN, PKC-NU, nPKC-NU

UniProt

O94806

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKD3 Rabbit Polyclonal Antibody (orb327364) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005264294

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPRD

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC6 (ready to use) Mouse Monoclonal Antibody
orb544676-01 3 mL

MUC6 (ready to use) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
MUC6 (ready to use) Mouse Monoclonal Antibody
orb544676-02 6 mL

MUC6 (ready to use) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Ziprasidone Sulfoxide
CS-T-62844 1 Each

Ziprasidone Sulfoxide

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Glucuronidase Beta (GUSb)
MBS2054957-01 0.1 mL

APC-Linked Polyclonal Antibody to Glucuronidase Beta (GUSb)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Glucuronidase Beta (GUSb)
MBS2054957-02 0.2 mL

APC-Linked Polyclonal Antibody to Glucuronidase Beta (GUSb)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Glucuronidase Beta (GUSb)
MBS2054957-03 0.5 mL

APC-Linked Polyclonal Antibody to Glucuronidase Beta (GUSb)

Sign In for Pricing
View Details