Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKD3 Peptide - middle region

PRKD3 Peptide - middle region

Product Specifications

Product Name Alternative

EPK2, PKD3, PRKCN, PKC-NU, nPKC-NU

UniProt

O94806

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKD3 Rabbit Polyclonal Antibody (orb327364) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005264294

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPRD

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 Antibody / Melan-A
orb1822769 100 µg

MART-1 Antibody / Melan-A

Sign In for Pricing
View Details
Mouse Platelet Derived Growth Factor C (PDGFC) ELISA Kit
RD-PDGFC-Mu-96Tests 96 Tests

Mouse Platelet Derived Growth Factor C (PDGFC) ELISA Kit

Sign In for Pricing
View Details
APOLD1 Protein Vector (Human) (pPM-C-HA)
PV062755 500 ng

APOLD1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Cactin (C-2) : m-IgGκ BP-HRP Bundle
sc-536328 1 Kit

Cactin (C-2) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Recombinant human XCL1/Lymphotactin protein
ATGP0316-250 250 µg

Recombinant human XCL1/Lymphotactin protein

Sign In for Pricing
View Details
Recombinant Moorella thermoacetica Holo-[acyl-carrier-protein] synthase (acpS)
MBS1453796-01 0.02 mg (E-Coli)

Recombinant Moorella thermoacetica Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details