Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DESI1 Peptide - C-terminal region

DESI1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DESI1, FAM152B, PPPDE2

UniProt

Q6ICB0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DESI1 Rabbit Polyclonal Antibody (orb327369) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_056519

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit adenine nucleotide translocator (ANT) autoantibody ELISA kit
GTR10395151 96 Well

Rabbit adenine nucleotide translocator (ANT) autoantibody ELISA kit

Sign In for Pricing
View Details
CNR4 Antibody
orb837376 2 mg

CNR4 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal EN-RAGE/S100A12 Antibody (133) [DyLight 680]
NBP2-89816FR 0.1 mL

Rabbit Monoclonal EN-RAGE/S100A12 Antibody (133) [DyLight 680]

Sign In for Pricing
View Details
C3H/10T1/2,Clone 8
ABC-TC0096 1 Vial

C3H/10T1/2,Clone 8

Sign In for Pricing
View Details
Lias (NM_024471) Mouse Tagged ORF Clone
MR205779 10 µg

Lias (NM_024471) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
RISC (SCPEP1) (NM_021626) Human Over-expression Lysate
LS059342-100ug 100 µg

RISC (SCPEP1) (NM_021626) Human Over-expression Lysate

Sign In for Pricing
View Details