Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DESI1 Peptide - C-terminal region

DESI1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DESI1, FAM152B, PPPDE2

UniProt

Q6ICB0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DESI1 Rabbit Polyclonal Antibody (orb327369) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_056519

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (Biotin) discontinued
516349-01 25 µg

CD4 (Biotin) discontinued

Sign In for Pricing
View Details
CD4 (Biotin) discontinued
516349-02 100 µg

CD4 (Biotin) discontinued

Sign In for Pricing
View Details
Mouse Baiap3 Pre-designed siRNA Set A
SI101317A 1 Each

Mouse Baiap3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
GOAT Interleukin 13 (IL-13) ELISA Kit
YLA0056GO-01 48 Tests

GOAT Interleukin 13 (IL-13) ELISA Kit

Sign In for Pricing
View Details
GOAT Interleukin 13 (IL-13) ELISA Kit
YLA0056GO-02 96 Tests

GOAT Interleukin 13 (IL-13) ELISA Kit

Sign In for Pricing
View Details
Mouse Cholecystokinin (CCK) ELISA Kit
DLR-CCK-Mu-48T 48 Tests

Mouse Cholecystokinin (CCK) ELISA Kit

Sign In for Pricing
View Details