Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOX4 Peptide - C-terminal region

NOX4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NOX4, RENOX

UniProt

Q9NPH5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NOX4 Rabbit Polyclonal Antibody (orb588506) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Dichloro-5-nitrophenol
TRC-D432070-5G 5 g

2,4-Dichloro-5-nitrophenol

Sign In for Pricing
View Details
Human MRPS16 activation kit by CRISPRa
GA109504 1 Kit

Human MRPS16 activation kit by CRISPRa

Sign In for Pricing
View Details
Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody [Clone ID: OTI5D8]
CF813020 100 µg

Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody [Clone ID: OTI5D8]

Sign In for Pricing
View Details
Alg14 Mouse Gene Knockout Kit (CRISPR)
KN501137 1 Kit

Alg14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Rat IgG,
AA-2308-1 1 mL

Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Rat IgG,

Sign In for Pricing
View Details
ATG10 Antibody
KC-7524-01 50 μL

ATG10 Antibody

Sign In for Pricing
View Details