Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOX4 Peptide - C-terminal region

NOX4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NOX4, RENOX

UniProt

Q9NPH5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NOX4 Rabbit Polyclonal Antibody (orb588506) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Misonidazole
TRC-M368700-10MG 10 mg

Misonidazole

Sign In for Pricing
View Details
ROBO2 Rabbit Polyclonal Antibody
TA371489 100 µL

ROBO2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
USP18 antibody
FNab09313 100 µg

USP18 antibody

Sign In for Pricing
View Details
GAB4 Antibody
8C12388-AAT 50 µg

GAB4 Antibody

Sign In for Pricing
View Details
2-Amino-6-[(4-fluorobenzyl)-amino]-3-nitropyridine
TRC-A618470-500MG 500 mg

2-Amino-6-[(4-fluorobenzyl)-amino]-3-nitropyridine

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701935 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details