Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIF3L1 Peptide - middle region

NIF3L1 Peptide - middle region

Product Specifications

Product Name Alternative

CALS-7, MDS015, ALS2CR1

UniProt

Q9GZT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NIF3L1 Rabbit Polyclonal Antibody (orb327384) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WLAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLDKVMSAVKGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD53 (NM_001115116) Human Over-expression Lysate
LC426523 20 µg

ANKRD53 (NM_001115116) Human Over-expression Lysate

Sign In for Pricing
View Details
Cadherin 24 (CDH24) (NM_022478) Human Recombinant Protein
TP314783 20 µg

Cadherin 24 (CDH24) (NM_022478) Human Recombinant Protein

Sign In for Pricing
View Details
IL4 antibody
FNab09861 100 µg

IL4 antibody

Sign In for Pricing
View Details
Recombinant Mouse ART4/CD297 Protein (Fc Tag)
PKSM040363 100 µg

Recombinant Mouse ART4/CD297 Protein (Fc Tag)

Sign In for Pricing
View Details
KCNAB3 Rabbit Polyclonal Antibody
TA377697 100 µL

KCNAB3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MFluor™ Violet 610 maleimide
1613-AAT 1 mg

MFluor™ Violet 610 maleimide

Sign In for Pricing
View Details