Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIF3L1 Peptide - middle region

NIF3L1 Peptide - middle region

Product Specifications

Product Name Alternative

CALS-7, MDS015, ALS2CR1

UniProt

Q9GZT8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NIF3L1 Rabbit Polyclonal Antibody (orb327384) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WLAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLDKVMSAVKGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2'-O-(5-O-Phosphono-beta-D-ribofuranosyl)adenosine Ammonium Salt
TRC-P774450-25MG 25 mg

2'-O-(5-O-Phosphono-beta-D-ribofuranosyl)adenosine Ammonium Salt

Sign In for Pricing
View Details
Chitobiose Dihydrochloride
TRC-C315003-1MG 1 mg

Chitobiose Dihydrochloride

Sign In for Pricing
View Details
IL-1 beta Antibody
KC-027-01 50 μL

IL-1 beta Antibody

Sign In for Pricing
View Details
IL-1 beta Antibody
KC-027-02 100 µL

IL-1 beta Antibody

Sign In for Pricing
View Details
IL-1 beta Antibody
KC-027-03 1 mL

IL-1 beta Antibody

Sign In for Pricing
View Details
Monkey RETN Antibody Pair Set
E-KAB-0662 50 µL & 100 µg

Monkey RETN Antibody Pair Set

Sign In for Pricing
View Details