MLST8 Peptide - N-terminal region
MLST8 Peptide - N-terminal region
Product Specifications
Product Name Alternative
GBL, LST8, POP3, WAT1, GbetaL
UniProt
Q9BVC4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MLST8 Rabbit Polyclonal Antibody (orb588521) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB0994-100 1x 100 µL
TNF alpha (J2D10), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSH032942-01 10 µg
Recombinant Human Pro-Neuregulin-1/NRG1-β1 Protein (aa 176-246)
Sign In for Pricing
View Details