Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLST8 Peptide - N-terminal region

MLST8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GBL, LST8, POP3, WAT1, GbetaL

UniProt

Q9BVC4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MLST8 Rabbit Polyclonal Antibody (orb588521) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (ITGAL) Mouse Monoclonal Antibody [Clone ID: OFYS]
AM05207RP-N 100 Tests

CD11a (ITGAL) Mouse Monoclonal Antibody [Clone ID: OFYS]

Sign In for Pricing
View Details
PSMC6 Antibody
8C14017-AAT 50 µg

PSMC6 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Antibody
TA397180S 25 µL

Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD32A (FCGR2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13D7]
TA500648AM 100 µL

CD32A (FCGR2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13D7]

Sign In for Pricing
View Details
Biotinyl Tyramide
SIH-573-20MG 20 mg

Biotinyl Tyramide

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2442), Biotin conjugate, 0.1mg/mL
BNCB2442-500 1x 500 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2442), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details