Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDLIM2 Peptide - C-terminal region

PDLIM2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SLIM, MYSTIQUE

UniProt

Q96JY6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDLIM2 Rabbit Polyclonal Antibody (orb327389) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_932159

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQENREGRAAPRQSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf5 Protein Vector (Human) (pPB-His-GST)
PV329111 500 ng

C16orf5 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Can f 6 IgE Antibody
abx422348-01 100 µg

Can f 6 IgE Antibody

Sign In for Pricing
View Details
Can f 6 IgE Antibody
abx422348-02 1 mg

Can f 6 IgE Antibody

Sign In for Pricing
View Details
Hepatic Leukemia Factor (HLF) Antibody
abx215948-01 50 µg

Hepatic Leukemia Factor (HLF) Antibody

Sign In for Pricing
View Details
Hepatic Leukemia Factor (HLF) Antibody
abx215948-02 100 µg

Hepatic Leukemia Factor (HLF) Antibody

Sign In for Pricing
View Details
Durantoside II
HY-N3791 1 Each

Durantoside II

Sign In for Pricing
View Details