Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDLIM2 Peptide - C-terminal region

PDLIM2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SLIM, MYSTIQUE

UniProt

Q96JY6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDLIM2 Rabbit Polyclonal Antibody (orb327389) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_932159

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQENREGRAAPRQSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLAU, 21-431aa, Human, His tag, Baculovirus (Bioactivity Validated)
E53A03432 50 µg

PLAU, 21-431aa, Human, His tag, Baculovirus (Bioactivity Validated)

Sign In for Pricing
View Details
TAAR5 Antibody, Biotin conjugated
CSB-PA023057LD01HU-01 50 µg

TAAR5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TAAR5 Antibody, Biotin conjugated
CSB-PA023057LD01HU-02 100 µg

TAAR5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SLC7A11/xCT Polyclonal Antibody
MBS2575795-01 0.06 mL

SLC7A11/xCT Polyclonal Antibody

Sign In for Pricing
View Details
SLC7A11/xCT Polyclonal Antibody
MBS2575795-02 0.12 mL

SLC7A11/xCT Polyclonal Antibody

Sign In for Pricing
View Details
SLC7A11/xCT Polyclonal Antibody
MBS2575795-03 0.2 mL

SLC7A11/xCT Polyclonal Antibody

Sign In for Pricing
View Details