Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUCKS1 Peptide - middle region

NUCKS1 Peptide - middle region

Product Specifications

Product Name Alternative

JC7, NUCKS

UniProt

Q9H1E3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUCKS1 Rabbit Polyclonal Antibody (orb327392) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR84 Protein Lysate (Human) with C-Ha Tag
22590031 100 µg

GPR84 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Polyclonal Antibody to Activin A Receptor Type I (ACVR1)
MBS2005165-01 0.1 mL

Polyclonal Antibody to Activin A Receptor Type I (ACVR1)

Sign In for Pricing
View Details
Polyclonal Antibody to Activin A Receptor Type I (ACVR1)
MBS2005165-02 0.2 mL

Polyclonal Antibody to Activin A Receptor Type I (ACVR1)

Sign In for Pricing
View Details
Polyclonal Antibody to Activin A Receptor Type I (ACVR1)
MBS2005165-03 0.5 mL

Polyclonal Antibody to Activin A Receptor Type I (ACVR1)

Sign In for Pricing
View Details
Polyclonal Antibody to Activin A Receptor Type I (ACVR1)
MBS2005165-04 1 mL

Polyclonal Antibody to Activin A Receptor Type I (ACVR1)

Sign In for Pricing
View Details
Polyclonal Antibody to Activin A Receptor Type I (ACVR1)
MBS2005165-05 5 mL

Polyclonal Antibody to Activin A Receptor Type I (ACVR1)

Sign In for Pricing
View Details