Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUCKS1 Peptide - middle region

NUCKS1 Peptide - middle region

Product Specifications

Product Name Alternative

JC7, NUCKS

UniProt

Q9H1E3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUCKS1 Rabbit Polyclonal Antibody (orb327392) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECOTIN Recombinant Protein
32-2303-10 10 µg

ECOTIN Recombinant Protein

Sign In for Pricing
View Details
Phka1 sgRNA CRISPR Lentivector set (Rat)
K7113501 3x 1.0 µg

Phka1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Genomic DNA - Lupus: Uterus, from a single donor
D1236274Lup 50 µg

Genomic DNA - Lupus: Uterus, from a single donor

Sign In for Pricing
View Details
Lentiviral mouse Hmgn1 shRNA (UAS) - Lentiviral mouse Hmgn1 shRNA (UAS) plasmid
GTR15122419 1 Vial

Lentiviral mouse Hmgn1 shRNA (UAS) - Lentiviral mouse Hmgn1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
SLC10A6 Antibody
MBS9524096-01 0.04 mL

SLC10A6 Antibody

Sign In for Pricing
View Details
SLC10A6 Antibody
MBS9524096-02 0.1 mL

SLC10A6 Antibody

Sign In for Pricing
View Details