SPATS2 Peptide - C-terminal region
SPATS2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
SCR59, P59SCR, SPATA10, Nbla00526
UniProt
Q86XZ4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SPATS2 Rabbit Polyclonal Antibody (orb327395) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_075559
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EVLPGNRRGGQGYRPQGQKSNDPMNQGRHDSMGRYRNSSWYSSGSRYQSA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1214-500 1x 500 µL
Luteinizing Hormone beta (LH beta) (LHb/1214), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![FHIT Mouse Monoclonal Antibody [Clone ID: OTI1D7]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908b42/imageurl/cf811440.webp)
![Cdc27 Recombinant Rabbit Monoclonal Antibody [SD85-02]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea8142c/imageurl/et1612-94.webp)
ET1612-94 100 µL
Cdc27 Recombinant Rabbit Monoclonal Antibody [SD85-02]
Sign In for Pricing
View Details ![ARHGAP25 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D8]](https://cdn.genprice.uk/products/937/68dd1b68061270361ea14f50/imageurl/ta501747bm.webp)
TA501747BM 100 µL
ARHGAP25 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D8]
Sign In for Pricing
View Details