Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATS2 Peptide - C-terminal region

SPATS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SCR59, P59SCR, SPATA10, Nbla00526

UniProt

Q86XZ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPATS2 Rabbit Polyclonal Antibody (orb327396) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_075559

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLKKSIDSFGQVSHPKNSYSTRSRCSSVTSVSLSSPSDASAASSSTCASP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIN1 (C-term) Rabbit Polyclonal Antibody
AP51841PU-N 400 µL

GIN1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FNBP1L Polyclonal Antibody
E-AB-19876-01 20 µL

FNBP1L Polyclonal Antibody

Sign In for Pricing
View Details
FNBP1L Polyclonal Antibody
E-AB-19876-02 60 µL

FNBP1L Polyclonal Antibody

Sign In for Pricing
View Details
FNBP1L Polyclonal Antibody
E-AB-19876-03 120 µL

FNBP1L Polyclonal Antibody

Sign In for Pricing
View Details
FNBP1L Polyclonal Antibody
E-AB-19876-04 200 µL

FNBP1L Polyclonal Antibody

Sign In for Pricing
View Details
C18orf54 Mouse Monoclonal Antibody [Clone ID: OTI2B2]
CF808319 100 µg

C18orf54 Mouse Monoclonal Antibody [Clone ID: OTI2B2]

Sign In for Pricing
View Details