Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSEN34 Peptide - C-terminal region

TSEN34 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LENG5, PCH2C, SEN34, SEN34L

UniProt

Q9BSV6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TSEN34 Rabbit Polyclonal Antibody (orb327398) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_076980

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRSALLVQLATARPRPVKARPLDWRVQSKDWPHAGRPAHELRYSIYRDLW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal RIPPLY2 Antibody (OTI1B5) [PerCP]
NBP2-73913PCP 0.1 mL

Mouse Monoclonal RIPPLY2 Antibody (OTI1B5) [PerCP]

Sign In for Pricing
View Details
Human SFRP1 Antibody, InVivo Block/Neutralizing Antibody
ANT-37404-1mg 1 mg

Human SFRP1 Antibody, InVivo Block/Neutralizing Antibody

Sign In for Pricing
View Details
Lentiviral human UNC5C sgRNA gene knockout kit - Lentiviral human UNC5C sgRNA gene knockout kit (plasmid)
GTR15365267 1 Vial

Lentiviral human UNC5C sgRNA gene knockout kit - Lentiviral human UNC5C sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
MIRacle™ mmu-miR-505-5p miRNA Agomir/Antagomir
AM3413 2 OD, 4 OD, 50 OD

MIRacle™ mmu-miR-505-5p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
6-Chloro-2-ethylimidazo[1,2-a]pyridine-3-carboxylic acid
OR77020-01 100 mg

6-Chloro-2-ethylimidazo[1,2-a]pyridine-3-carboxylic acid

Sign In for Pricing
View Details
6-Chloro-2-ethylimidazo[1,2-a]pyridine-3-carboxylic acid
OR77020-02 250 mg

6-Chloro-2-ethylimidazo[1,2-a]pyridine-3-carboxylic acid

Sign In for Pricing
View Details