RNASEH2B Peptide - C-terminal region
RNASEH2B Peptide - C-terminal region
Product Specifications
Product Name Alternative
AGS2, DLEU8
UniProt
Q5TBB1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RNASEH2B Rabbit Polyclonal Antibody (orb327399) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_078846
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SKYLKLPEPSASLPNPPSKKIKLSDEPVEAKEDYTKFNTKDLKTEKKNSK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
023850 96 Tests
Calcitonin Gene Related Peptide (CGRP) BioAssayTM ELISA Kit (Mouse)
Sign In for Pricing
View Details 
MBS6439589-01 0.1 mL
SUMO2 (Small Ubiquitin-related Modifier 2, HSMT3, MGC117191, SMT3B, SMT3H2, SUMO3, Smt3A,HSMT3,SMT3 homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A) (FITC)
Sign In for Pricing
View Details MBS6439589-02 5x 0.1 mL
SUMO2 (Small Ubiquitin-related Modifier 2, HSMT3, MGC117191, SMT3B, SMT3H2, SUMO3, Smt3A,HSMT3,SMT3 homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A) (FITC)
Sign In for Pricing
View Details