Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNASEH2B Peptide - C-terminal region

RNASEH2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

AGS2, DLEU8

UniProt

Q5TBB1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNASEH2B Rabbit Polyclonal Antibody (orb327399) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_078846

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKYLKLPEPSASLPNPPSKKIKLSDEPVEAKEDYTKFNTKDLKTEKKNSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF640R conjugate, 0.1mg/mL
BNC402316-100 1x 100 µL

Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DYKDDDDK-tagged Protein Purification Kit
EA-TP-K001 1Test

DYKDDDDK-tagged Protein Purification Kit

Sign In for Pricing
View Details
Human SIRT1 (Sirtuin 1) ELISA Kit
E-EL-H1546-01 24 Tests

Human SIRT1 (Sirtuin 1) ELISA Kit

Sign In for Pricing
View Details
Human SIRT1 (Sirtuin 1) ELISA Kit
E-EL-H1546-02 48 Tests

Human SIRT1 (Sirtuin 1) ELISA Kit

Sign In for Pricing
View Details
Human SIRT1 (Sirtuin 1) ELISA Kit
E-EL-H1546-03 96 Tests

Human SIRT1 (Sirtuin 1) ELISA Kit

Sign In for Pricing
View Details
CEP170 Antibody
8C15040-AAT 50 µg

CEP170 Antibody

Sign In for Pricing
View Details