CENPU Peptide - N-terminal region
CENPU Peptide - N-terminal region
Product Specifications
Product Name Alternative
CENPU, ICEN24, KLIP1, MLF1IP, PBIP1
UniProt
Q71F23
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CENPU Rabbit Polyclonal Antibody (orb588528) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MAPRGRRRPRPHRSEGARRSKNTLERTHSMKDKAGQKCKPIDVFDFPDNS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-41355R-APC-Cy7 100 µL
IL-20R alpha Polyclonal Antibody, APC-Cy7 Conjugated
Sign In for Pricing
View Details 
bs-9854R-BF555 100 µL
HSPβ7 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
Sign In for Pricing
View Details MBS6011204-01 0.05 mg
TAF8 (Transcription Initiation Factor TFIID Subunit 8, TBP-associated Factor 8, Protein Taube Nuss, TBN, TBP-associated Factor 43 kDa, Transcription Initiation Factor TFIID 43 kDa Subunit, TAFII-43, TAFII43, hTAFII43)
Sign In for Pricing
View Details MBS6011204-02 5x 0.05 mg
TAF8 (Transcription Initiation Factor TFIID Subunit 8, TBP-associated Factor 8, Protein Taube Nuss, TBN, TBP-associated Factor 43 kDa, Transcription Initiation Factor TFIID 43 kDa Subunit, TAFII-43, TAFII43, hTAFII43)
Sign In for Pricing
View Details NBP2-60240FR 0.1 mL
Mouse Monoclonal Glutamine Synthetase Antibody (8D7) [DyLight 680]
Sign In for Pricing
View Details