Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CENPU Peptide - N-terminal region

CENPU Peptide - N-terminal region

Product Specifications

Product Name Alternative

CENPU, ICEN24, KLIP1, MLF1IP, PBIP1

UniProt

Q71F23

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CENPU Rabbit Polyclonal Antibody (orb588528) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAPRGRRRPRPHRSEGARRSKNTLERTHSMKDKAGQKCKPIDVFDFPDNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ber-H2), CF647 conjugate, 0.1mg/mL
BNC470772-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ber-H2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATF6B CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
12617154 3x 1.0 µg DNA

ATF6B CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Human chitinase 1; Chitotriosidase, CHIT1 ELISA KIT
E4540Hu-01 48 Well

Human chitinase 1; Chitotriosidase, CHIT1 ELISA KIT

Sign In for Pricing
View Details
Human chitinase 1; Chitotriosidase, CHIT1 ELISA KIT
E4540Hu-02 96 Well

Human chitinase 1; Chitotriosidase, CHIT1 ELISA KIT

Sign In for Pricing
View Details
Human chitinase 1; Chitotriosidase, CHIT1 ELISA KIT
E4540Hu-03 5x 96 Tests

Human chitinase 1; Chitotriosidase, CHIT1 ELISA KIT

Sign In for Pricing
View Details
Human chitinase 1; Chitotriosidase, CHIT1 ELISA KIT
E4540Hu-04 10x 96 Tests

Human chitinase 1; Chitotriosidase, CHIT1 ELISA KIT

Sign In for Pricing
View Details