ISOC2 Peptide - N-terminal region
ISOC2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ISOC2
UniProt
Q96AB3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ISOC2 Rabbit Polyclonal Antibody (orb588530) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKFRHNIAYFPQIVSVAARMLKVARLLEVPVMLTEQYPQGLGPTVPELGT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470099-500 1x 500 µL
Human Nuclear Antigen (235-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
