Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHC3 Peptide - C-terminal region

PHC3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PHC3, EDR3, PH3

UniProt

Q8NDX5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHC3 Rabbit Polyclonal Antibody (orb331498) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005247847

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSRWNRKPDNQSLGHRGRRPSGPDGAAREHILRQLPITYPSAEEDLASHE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin, Smooth Muscle Heavy Chain (SMMS-1), CF488A conjugate, 0.1mg/mL
BNC880893-100 1x 100 µL

Myosin, Smooth Muscle Heavy Chain (SMMS-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Testis
CS644935 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details
HDGFL2 Antibody
KC-29877-01 50 μL

HDGFL2 Antibody

Sign In for Pricing
View Details
HDGFL2 Antibody
KC-29877-02 100 µL

HDGFL2 Antibody

Sign In for Pricing
View Details
HDGFL2 Antibody
KC-29877-03 1 mL

HDGFL2 Antibody

Sign In for Pricing
View Details
CD25/ IL2RA (Activated Lymphocyte Marker) (IL2RA/2395), CF640R conjugate, 0.1mg/mL
BNC402395-100 1x 100 µL

CD25/ IL2RA (Activated Lymphocyte Marker) (IL2RA/2395), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details