Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHC3 Peptide - C-terminal region

PHC3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PHC3, EDR3, PH3

UniProt

Q8NDX5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHC3 Rabbit Polyclonal Antibody (orb331498) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005247847

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSRWNRKPDNQSLGHRGRRPSGPDGAAREHILRQLPITYPSAEEDLASHE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

o-Cresol
TRC-C781910-50G 50 g

o-Cresol

Sign In for Pricing
View Details
MMAE Recombinant Rabbit Monoclonal Antibody [PSH0-04]
HA721257 100 µL

MMAE Recombinant Rabbit Monoclonal Antibody [PSH0-04]

Sign In for Pricing
View Details
Rat Agouti Related Protein (AGRP) ELISA Kit
RD-AGRP-Ra-01 96 Tests

Rat Agouti Related Protein (AGRP) ELISA Kit

Sign In for Pricing
View Details
Rat Agouti Related Protein (AGRP) ELISA Kit
RD-AGRP-Ra-02 48 Tests

Rat Agouti Related Protein (AGRP) ELISA Kit

Sign In for Pricing
View Details
Human FLJ14213 (PRR5L) activation kit by CRISPRa
GA112717 1 Kit

Human FLJ14213 (PRR5L) activation kit by CRISPRa

Sign In for Pricing
View Details
Propidium Iodide
#40016 1x 100 mg

Propidium Iodide

Sign In for Pricing
View Details