Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAA15 Peptide - middle region

NAA15 Peptide - middle region

Product Specifications

Product Name Alternative

NAA15, GA19, NARG1, NATH, TBDN100

UniProt

Q9BXJ9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAA15 Rabbit Polyclonal Antibody (orb588534) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_476516

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLKSCRLFNPNDDGKEEPPTTLLWVQYYLAQHYDKIGQPSIALEYINTAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAP1 (BRCA1 Associated Protein 1) (BAP1/2431), CF488A conjugate, 0.1mg/mL
BNC882431-100 1x 100 µL

BAP1 (BRCA1 Associated Protein 1) (BAP1/2431), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
iFluor™ 488 Conjugated FOXO1A Recombinant Rabbit Monoclonal Antibody [SU33-01]
HA720161F 100 µL

iFluor™ 488 Conjugated FOXO1A Recombinant Rabbit Monoclonal Antibody [SU33-01]

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS702970 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
N-Carbobenzyloxy-L-glutamic Acid O-Benzyl Ester
TRC-C176515-25G 25 g

N-Carbobenzyloxy-L-glutamic Acid O-Benzyl Ester

Sign In for Pricing
View Details
MSR1 Antibody
KC-11259-01 50 μL

MSR1 Antibody

Sign In for Pricing
View Details
MSR1 Antibody
KC-11259-02 100 µL

MSR1 Antibody

Sign In for Pricing
View Details