Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR82 Peptide - N-terminal region

WDR82 Peptide - N-terminal region

Product Specifications

Product Name Alternative

WDR82, TMEM113, WDR82A, UNQ9342/PRO34047

UniProt

Q6UXN9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR82 Rabbit Polyclonal Antibody (orb588537) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_079498

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS801246 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
P-Quaterphenyl
TRC-Q990068-50MG 50 mg

P-Quaterphenyl

Sign In for Pricing
View Details
Rps3a1 Mouse Gene Knockout Kit (CRISPR)
KN515103 1 Kit

Rps3a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAR alpha Rabbit Polyclonal Antibody
ER1706-81 100 µL

RAR alpha Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Propionyl-d5 Glycine
TRC-P788502-25MG 25 mg

Propionyl-d5 Glycine

Sign In for Pricing
View Details
TIM 3 (HAVCR2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]
TA812558AM 100 µL

TIM 3 (HAVCR2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]

Sign In for Pricing
View Details