Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR82 Peptide - N-terminal region

WDR82 Peptide - N-terminal region

Product Specifications

Product Name Alternative

WDR82, TMEM113, WDR82A, UNQ9342/PRO34047

UniProt

Q6UXN9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR82 Rabbit Polyclonal Antibody (orb588537) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_079498

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Benzyloxy-1-bromobutane (~90%)
TRC-B291445-250MG 250 mg

4-Benzyloxy-1-bromobutane (~90%)

Sign In for Pricing
View Details
Creatinine
TRC-C781500-50MG 50 mg

Creatinine

Sign In for Pricing
View Details
1-Butylpyrrolidine
TRC-B700948-500MG 500 mg

1-Butylpyrrolidine

Sign In for Pricing
View Details
CD133 (PROM1) Mouse Monoclonal Antibody [Clone ID: OTI5D5]
CF813576 100 µg

CD133 (PROM1) Mouse Monoclonal Antibody [Clone ID: OTI5D5]

Sign In for Pricing
View Details
TIMP1 Recombinant Antibody
V3596IHC-7ML 7 mL

TIMP1 Recombinant Antibody

Sign In for Pricing
View Details
LYVE1 Mouse Monoclonal Antibody [Clone ID: OTI11C1]
CF812237 100 µg

LYVE1 Mouse Monoclonal Antibody [Clone ID: OTI11C1]

Sign In for Pricing
View Details