Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

URM1 Peptide - N-terminal region

URM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

URM1 {ECO:0000255|HAMAP-Rule:MF_03048

UniProt

Q9BTM9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with URM1 Rabbit Polyclonal Antibody (orb588539) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_112176

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITM2A AAV Vector (Mouse) (CMV)
25193104 1 µg

ITM2A AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
SLC7A9 Antibody
E912848 100 µL

SLC7A9 Antibody

Sign In for Pricing
View Details
Acr sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
11206114 3x 1.0 µg

Acr sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
CSDE1 Knockout GIST-T1 Polyclonal Cells
ARG12545 1 Million

CSDE1 Knockout GIST-T1 Polyclonal Cells

Sign In for Pricing
View Details
4933405L10Rik Double Nickase Plasmid (m2)
sc-427867-NIC-2 20 µg

4933405L10Rik Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
TIE1 Rabbit Polyclonal Antibody (PE-Cy7)
orb911999 100 µL

TIE1 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details