URM1 Peptide - N-terminal region
URM1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
URM1 {ECO:0000255|HAMAP-Rule:MF_03048
UniProt
Q9BTM9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with URM1 Rabbit Polyclonal Antibody (orb588539) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_112176
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC225078L4V 200 µL
CD59 (NM_001127223) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
23998154 3x 1.0 µg DNA
HSPA1A CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
Sign In for Pricing
View Details 