Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3BGRL3 Peptide - N-terminal region

SH3BGRL3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TIP-B1, SH3BP-1, HEL-S-297

UniProt

Q9H299

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH3BGRL3 Rabbit Polyclonal Antibody (orb327407) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_112576

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSHR (Thyrotropin Receptor, Thyroid-stimulating Hormone Receptor, TSH-R, LGR3)
338351-01 50 µL

TSHR (Thyrotropin Receptor, Thyroid-stimulating Hormone Receptor, TSH-R, LGR3)

Sign In for Pricing
View Details
TSHR (Thyrotropin Receptor, Thyroid-stimulating Hormone Receptor, TSH-R, LGR3)
338351-02 100 µL

TSHR (Thyrotropin Receptor, Thyroid-stimulating Hormone Receptor, TSH-R, LGR3)

Sign In for Pricing
View Details
PPT1 Mouse monoclonal antibody
orb2298465-01 25 µL

PPT1 Mouse monoclonal antibody

Sign In for Pricing
View Details
PPT1 Mouse monoclonal antibody
orb2298465-02 100 µL

PPT1 Mouse monoclonal antibody

Sign In for Pricing
View Details
Recombinant Human TNF alpha Protein, Avi His Tag
KMP2133 100 µg

Recombinant Human TNF alpha Protein, Avi His Tag

Sign In for Pricing
View Details
Rabbit Polyclonal BTBD7 Antibody
NBP2-92399-0.1mL 0.1 mL

Rabbit Polyclonal BTBD7 Antibody

Sign In for Pricing
View Details