Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3BGRL3 Peptide - N-terminal region

SH3BGRL3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TIP-B1, SH3BP-1, HEL-S-297

UniProt

Q9H299

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH3BGRL3 Rabbit Polyclonal Antibody (orb327407) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_112576

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Bcl-6 Antibody (BCL6/2497R) [DyLight 755]
NBP3-08313IR 100 µL

Rabbit Monoclonal Bcl-6 Antibody (BCL6/2497R) [DyLight 755]

Sign In for Pricing
View Details
Ilf3 ORF Vector (Mouse) (pORF)
ORF047905 1.0 µg DNA

Ilf3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
FAM150A Polyclonal Antibody
MBS9238495-01 0.1 mL

FAM150A Polyclonal Antibody

Sign In for Pricing
View Details
FAM150A Polyclonal Antibody
MBS9238495-02 5x 0.1 mL

FAM150A Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Solute carrier family 15 member 2,SLC15A2 ELISA KIT
ELI-39271Ra 96 Tests

Rabbit Solute carrier family 15 member 2,SLC15A2 ELISA KIT

Sign In for Pricing
View Details
Baz1b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6366906 1.0 µg DNA

Baz1b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details