Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSRC1 Peptide - C-terminal region

PSRC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PSRC1, DDA3, FP3214

UniProt

Q6PGN9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSRC1 Rabbit Polyclonal Antibody (orb588540) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGSGEFVGLTLKFLHPSPPGPPTPIRSVLAPQPSTSNSQRLPRPQGAAAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAT2B Polyclonal Antibody
MBS8566103-01 0.1 mL

KAT2B Polyclonal Antibody

Sign In for Pricing
View Details
KAT2B Polyclonal Antibody
MBS8566103-02 0.1 mL (AF405L)

KAT2B Polyclonal Antibody

Sign In for Pricing
View Details
KAT2B Polyclonal Antibody
MBS8566103-03 0.1 mL (AF405S)

KAT2B Polyclonal Antibody

Sign In for Pricing
View Details
KAT2B Polyclonal Antibody
MBS8566103-04 0.1 mL (AF610)

KAT2B Polyclonal Antibody

Sign In for Pricing
View Details
KAT2B Polyclonal Antibody
MBS8566103-05 0.1 mL (AF635)

KAT2B Polyclonal Antibody

Sign In for Pricing
View Details
KAT2B Polyclonal Antibody
MBS8566103-06 0.1 mL (APC)

KAT2B Polyclonal Antibody

Sign In for Pricing
View Details