Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSRC1 Peptide - C-terminal region

PSRC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PSRC1, DDA3, FP3214

UniProt

Q6PGN9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSRC1 Rabbit Polyclonal Antibody (orb588540) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGSGEFVGLTLKFLHPSPPGPPTPIRSVLAPQPSTSNSQRLPRPQGAAAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CHD9 shRNA (UAS) - Lentiviral human CHD9 shRNA (UAS, RFP) (100)
GTR15159048 1 Vial

Lentiviral human CHD9 shRNA (UAS) - Lentiviral human CHD9 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Anti-Aconitase 2 Antibody Picoband® (monoclonal, 4C12D1)-FITC Conjugate
M03096-3-FITC 100 µg/Vial

Anti-Aconitase 2 Antibody Picoband® (monoclonal, 4C12D1)-FITC Conjugate

Sign In for Pricing
View Details
Trim54 Mouse qPCR Primer Pair (NM_021447)
MP217591 200 Reactions

Trim54 Mouse qPCR Primer Pair (NM_021447)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O157:H7 ENVR Polyclonal Antibody
MBS7163591 Inquire

Rabbit anti-Escherichia coli O157:H7 ENVR Polyclonal Antibody

Sign In for Pricing
View Details
Cavy Vitamin K Epoxide Reductase Complex Subunit 1 (VKORC1) ELISA Kit
MBS9940182 Inquire

Cavy Vitamin K Epoxide Reductase Complex Subunit 1 (VKORC1) ELISA Kit

Sign In for Pricing
View Details
Anti-MMP10 Picoband Antibody
MBS1750851-01 0.01 mg

Anti-MMP10 Picoband Antibody

Sign In for Pricing
View Details