Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP41 Peptide - middle region

CEP41 Peptide - middle region

Product Specifications

Product Name Alternative

CEP41, TSGA14

UniProt

Q9BYV8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEP41 Rabbit Polyclonal Antibody (orb588544) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IATLSRTMNPYSNDILEYKNAHGKIIILYDDDERLASQAATTMCERGFEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C5orf19 (REEP2) Mouse Monoclonal Antibody [Clone ID: LBI2C7]
AMM12349V 100 µL

C5orf19 (REEP2) Mouse Monoclonal Antibody [Clone ID: LBI2C7]

Sign In for Pricing
View Details
PRMT8  polyclonal antibody
BS78342 50ul

PRMT8 polyclonal antibody

Sign In for Pricing
View Details
NGAL (LCN2) Mouse Monoclonal Antibody [Clone ID: LBI3C11]
AMM21504V 100 µL

NGAL (LCN2) Mouse Monoclonal Antibody [Clone ID: LBI3C11]

Sign In for Pricing
View Details
IDO1, 1-403aa, Human, His tag, E.coli
E53A02561 50 µg

IDO1, 1-403aa, Human, His tag, E.coli

Sign In for Pricing
View Details
SFXN1 (NM_022754) Human Tagged ORF Clone
RG208640 10 µg

SFXN1 (NM_022754) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Leucine-rich repeat LGI family member 3 (LGI3) ELISA Kit
EK10092 48 Tests

Mouse Leucine-rich repeat LGI family member 3 (LGI3) ELISA Kit

Sign In for Pricing
View Details