Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP41 Peptide - middle region

CEP41 Peptide - middle region

Product Specifications

Product Name Alternative

CEP41, TSGA14

UniProt

Q9BYV8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEP41 Rabbit Polyclonal Antibody (orb588544) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IATLSRTMNPYSNDILEYKNAHGKIIILYDDDERLASQAATTMCERGFEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Palmitoyl-protein thioesterase 1 (PPT1) ELISA Kit
orb1675389-01 48 Tests

Human Palmitoyl-protein thioesterase 1 (PPT1) ELISA Kit

Sign In for Pricing
View Details
Human Palmitoyl-protein thioesterase 1 (PPT1) ELISA Kit
orb1675389-02 96 Tests

Human Palmitoyl-protein thioesterase 1 (PPT1) ELISA Kit

Sign In for Pricing
View Details
CREB Antibody
MBS9504105-01 0.05 mL

CREB Antibody

Sign In for Pricing
View Details
CREB Antibody
MBS9504105-02 0.1 mL

CREB Antibody

Sign In for Pricing
View Details
CREB Antibody
MBS9504105-03 5x 0.1 mL

CREB Antibody

Sign In for Pricing
View Details
FCAR Antibody
orb2672620-01 50 µL

FCAR Antibody

Sign In for Pricing
View Details