Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF480 Peptide - N-terminal region

ZNF480 Peptide - N-terminal region

Product Specifications

UniProt

Q8WV37

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF480 Rabbit Polyclonal Antibody (orb327415) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_653285

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DEKAQKRRKRKAKESGMALPQGHLTFRDVAIEFSQAEWKCLDPAQRALYK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIK2 (salt-Inducible Kinase 2, DKFZp434K1115, KIAA0781, LOH11CR1I, QIK, SNF1LK2) (PE)
MBS6186040-01 0.1 mL

SIK2 (salt-Inducible Kinase 2, DKFZp434K1115, KIAA0781, LOH11CR1I, QIK, SNF1LK2) (PE)

Sign In for Pricing
View Details
SIK2 (salt-Inducible Kinase 2, DKFZp434K1115, KIAA0781, LOH11CR1I, QIK, SNF1LK2) (PE)
MBS6186040-02 5x 0.1 mL

SIK2 (salt-Inducible Kinase 2, DKFZp434K1115, KIAA0781, LOH11CR1I, QIK, SNF1LK2) (PE)

Sign In for Pricing
View Details
ZNF238 Rabbit pAb, PerCP-Cy7 conjugated
orb2875976 100 µL

ZNF238 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Mouse Monoclonal SOX2 Antibody (4G8) [Alexa Fluor 594]
NBP2-29623AF594 0.1 mL

Mouse Monoclonal SOX2 Antibody (4G8) [Alexa Fluor 594]

Sign In for Pricing
View Details
Vurolenatide
T9901A-1867-01 1 mg

Vurolenatide

Sign In for Pricing
View Details
Vurolenatide
T9901A-1867-02 5 mg

Vurolenatide

Sign In for Pricing
View Details