Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF480 Peptide - N-terminal region

ZNF480 Peptide - N-terminal region

Product Specifications

UniProt

Q8WV37

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF480 Rabbit Polyclonal Antibody (orb327415) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_653285

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DEKAQKRRKRKAKESGMALPQGHLTFRDVAIEFSQAEWKCLDPAQRALYK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSM (H-2) : m-IgG2b BP-HRP Bundle
sc-549403 1 Kit

OSM (H-2) : m-IgG2b BP-HRP Bundle

Sign In for Pricing
View Details
Ceacam10 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7187804 1.0 µg DNA

Ceacam10 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Paclobutrazol
AT199 1mg

Paclobutrazol

Sign In for Pricing
View Details
Anti-HEXB Antibody Picoband® (Carrier-free Conjugate)
PB9211-carrier-free 100 µg/Vial

Anti-HEXB Antibody Picoband® (Carrier-free Conjugate)

Sign In for Pricing
View Details
RPS16P5 ORF Vector (Human) (pORF)
42161011 1.0 µg DNA

RPS16P5 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human Arf GAP domain and FG repeats containing protein 1 (AGFG1) ELISA Kit
GTR10365977 96 Well

Human Arf GAP domain and FG repeats containing protein 1 (AGFG1) ELISA Kit

Sign In for Pricing
View Details