Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CERS6 Peptide - C-terminal region

CERS6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CERS6, LASS6

UniProt

Q6ZMG9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CERS6 Rabbit Polyclonal Antibody (orb588547) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_982288

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLNCFWSYLIVKIACKAVSRGKVSKDDRSDIESSSDEEDSEPPGKNPHTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cym (NM_020091) Rat Tagged Lenti ORF Clone
RR200797L3 10 µg

Cym (NM_020091) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Hoxa10 (NM_001122950) Mouse Tagged ORF Clone
MR223043 10 µg

Hoxa10 (NM_001122950) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PDK2 Conjugated Antibody
C49827 100 µL

PDK2 Conjugated Antibody

Sign In for Pricing
View Details
Human GJB1 activation kit by CRISPRa
GA101808 1 Kit

Human GJB1 activation kit by CRISPRa

Sign In for Pricing
View Details
14-3-3 Family Antibody Sampler Kit, BioAssayTM discontinued
473924 6x20ul

14-3-3 Family Antibody Sampler Kit, BioAssayTM discontinued

Sign In for Pricing
View Details
H2BC5 (NM_138720) Human Untagged Clone
SC309501 10 µg

H2BC5 (NM_138720) Human Untagged Clone

Sign In for Pricing
View Details