Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CERS6 Peptide - C-terminal region

CERS6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CERS6, LASS6

UniProt

Q6ZMG9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CERS6 Rabbit Polyclonal Antibody (orb588547) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_982288

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLNCFWSYLIVKIACKAVSRGKVSKDDRSDIESSSDEEDSEPPGKNPHTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS701188 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
PIGA Peptide - middle region (AAP74732)
AAP74732-100UG 100 µg

PIGA Peptide - middle region (AAP74732)

Sign In for Pricing
View Details
Anti-PNPLA5 Antibody
CQA9731-01 30 µL

Anti-PNPLA5 Antibody

Sign In for Pricing
View Details
Anti-PNPLA5 Antibody
CQA9731-02 50 μL

Anti-PNPLA5 Antibody

Sign In for Pricing
View Details
Anti-PNPLA5 Antibody
CQA9731-03 100 µL

Anti-PNPLA5 Antibody

Sign In for Pricing
View Details
Anti-PNPLA5 Antibody
CQA9731-04 200 µL

Anti-PNPLA5 Antibody

Sign In for Pricing
View Details