Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAX5 Peptide - middle region

PAX5 Peptide - middle region

Product Specifications

Product Name Alternative

PAX5

UniProt

Q02548

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAX5 Rabbit Polyclonal Antibody (orb573702) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT2 Polyclonal Antibody
E-AB-16142-01 20 µL

AKT2 Polyclonal Antibody

Sign In for Pricing
View Details
AKT2 Polyclonal Antibody
E-AB-16142-02 60 µL

AKT2 Polyclonal Antibody

Sign In for Pricing
View Details
AKT2 Polyclonal Antibody
E-AB-16142-03 120 µL

AKT2 Polyclonal Antibody

Sign In for Pricing
View Details
AKT2 Polyclonal Antibody
E-AB-16142-04 200 µL

AKT2 Polyclonal Antibody

Sign In for Pricing
View Details
CD73 (Immuno-Oncology Target) (NT5E/2545), 1mg/mL
BNUM2545-50 1x 50 µL

CD73 (Immuno-Oncology Target) (NT5E/2545), 1mg/mL

Sign In for Pricing
View Details
CHRM1 Polyclonal Antibody
E-AB-68285-01 60 µL

CHRM1 Polyclonal Antibody

Sign In for Pricing
View Details