Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAX5 Peptide - middle region

PAX5 Peptide - middle region

Product Specifications

Product Name Alternative

PAX5

UniProt

Q02548

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PAX5 Rabbit Polyclonal Antibody (orb573702) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leptomycin B
SIH-534-200UG 200 µg

Leptomycin B

Sign In for Pricing
View Details
Ido1 Mouse Gene Knockout Kit (CRISPR)
KN308091BN 1 Kit

Ido1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TTPAL Human Gene Knockout Kit (CRISPR)
KN400776 1 Kit

TTPAL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB510916 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
CHST2 Antibody (Biotin)
KB-26648-01 50 μL

CHST2 Antibody (Biotin)

Sign In for Pricing
View Details
CHST2 Antibody (Biotin)
KB-26648-02 100 µL

CHST2 Antibody (Biotin)

Sign In for Pricing
View Details