TFAP2A Peptide - C-terminal region
TFAP2A Peptide - C-terminal region
Product Specifications
Product Name Alternative
AP-2, BOFS, AP2TF, TFAP2, AP-2alpha
UniProt
P05549
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TFAP2A Rabbit Polyclonal Antibody (orb324371) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_003211
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY424109 100 µg
C9orf115 (PTRH1) (NM_001002913) Human Over-expression Lysate
Sign In for Pricing
View Details 
