Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASCL1 Peptide - N-terminal region

ASCL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ASCL1, ASH1, BHLHA46, HASH1

UniProt

P50553

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASCL1 Rabbit Polyclonal Antibody (orb573779) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004307

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r81 Mouse qPCR Primer Pair (NM_175936)
MP218392 200 Reactions

Vmn2r81 Mouse qPCR Primer Pair (NM_175936)

Sign In for Pricing
View Details
ELISA kit for Human CAM (Calmodulin)
E-EL-H0625 96 Tests

ELISA kit for Human CAM (Calmodulin)

Sign In for Pricing
View Details
Small Molecule Immuno-Oncology Compound Library
C06770 100 μL/Well

Small Molecule Immuno-Oncology Compound Library

Sign In for Pricing
View Details
GAPDHP37 ORF Vector (Human) (pORF)
ORF020021 1.0 µg DNA

GAPDHP37 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rabbit Anti-Duck IgY H&L Antibody (AF633)
abx142477-01 100 µL

Rabbit Anti-Duck IgY H&L Antibody (AF633)

Sign In for Pricing
View Details
Rabbit Anti-Duck IgY H&L Antibody (AF633)
abx142477-02 500 µL

Rabbit Anti-Duck IgY H&L Antibody (AF633)

Sign In for Pricing
View Details