Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASCL1 Peptide - N-terminal region

ASCL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ASCL1, ASH1, BHLHA46, HASH1

UniProt

P50553

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASCL1 Rabbit Polyclonal Antibody (orb573779) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004307

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 Rabbit Polyclonal Antibody (BF647)
orb2415371 100 µL

CD20 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
SLC35B2 Human Over-expression Lysate
orb1374760 20 µg

SLC35B2 Human Over-expression Lysate

Sign In for Pricing
View Details
Cytochrome C (CYCS, CYC) APC
MBS6375612-01 0.1 mL

Cytochrome C (CYCS, CYC) APC

Sign In for Pricing
View Details
Cytochrome C (CYCS, CYC) APC
MBS6375612-02 5x 0.1 mL

Cytochrome C (CYCS, CYC) APC

Sign In for Pricing
View Details
Olfr666 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
33345154 3x 1.0 µg DNA

Olfr666 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
RUNX2 Rabbit Monoclonal Antibody
TA422760 100 µL

RUNX2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details